PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_F83CB32DD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 290aa    MW: 32303.8 Da    PI: 5.5635
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_F83CB32DD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-172572148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Traes_4BS_F83CB32DD.1 25 RGPWTVDEDLTLINYIADHGEGRWNALARAAGLRRTGKSCRLRWLNYL 72
                           89********************************************97 PP

2Myb_DNA-binding55.71.1e-1778121146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_4BS_F83CB32DD.1  78 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                            89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4042072IPR017930Myb domain
SuperFamilySSF466893.15E-3023119IPR009057Homeodomain-like
SMARTSM007171.1E-142474IPR001005SANT/Myb domain
PfamPF002498.0E-162572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-222679IPR009057Homeodomain-like
CDDcd001672.69E-112772No hitNo description
PROSITE profilePS5129423.8673127IPR017930Myb domain
SMARTSM007171.2E-1577125IPR001005SANT/Myb domain
PfamPF002494.1E-1678121IPR001005SANT/Myb domain
CDDcd001674.77E-1280121No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2480126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDMVLQSRSS NSMAAEPEEE AELRRGPWTV DEDLTLINYI ADHGEGRWNA LARAAGLRRT  60
GKSCRLRWLN YLRPDVKRGN FTADEQLLIL DLHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHAKQL NCDVGSATFK DAMRYLWMPH LVERIHAAAA TAGGDPTMGD TSCASGVTSM  180
AATATTYPDN NSPASAVTTS RSASSGSFTS ELCGEEKNLQ VHGSGEKTTS GGDWMQDADQ  240
EFWAMHMQIQ PDDGGLFHVD HELSGWVQGF SDVGVSADNL WSLEDIWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-252211924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090180.0BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618000.11e-123PREDICTED: transcription factor MYB108
SwissprotQ9LDE12e-75MY108_ARATH; Transcription factor MYB108
TrEMBLW5EEJ80.0W5EEJ8_WHEAT; Uncharacterized protein
STRINGLOC_Os11g45740.11e-122(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-67myb domain protein 78
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]